
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-STRC Antibody
상품 한눈에 보기
인간 STRC 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구용에 적합합니다. 토끼 유래 IgG 형식이며, PrEST 항원으로 정제되었습니다. 인간 특이성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048083-100 Anti-STRC Antibody, stereocilin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048083-25 Anti-STRC Antibody, stereocilin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-STRC Antibody
Anti-STRC Antibody
Target Information
- Target Protein: Stereocilin
- Target Gene: STRC
- Alternative Gene Name: DFNB16
Product Description
Polyclonal antibody against human STRC (stereocilin). Recommended for immunohistochemistry and other research applications.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000014845 (87%)
- Mouse ENSMUSG00000033498 (86%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as ligand |
| Recommended Applications | Immunohistochemistry (IHC) and related assays |
| Safety Information | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



