Atlas Antibodies Anti-STRC Antibody

상품 한눈에 보기

인간 STRC 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구용에 적합합니다. 토끼 유래 IgG 형식이며, PrEST 항원으로 정제되었습니다. 인간 특이성 검증 완료.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048083-100 Anti-STRC Antibody, stereocilin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048083-25 Anti-STRC Antibody, stereocilin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-STRC Antibody

Anti-STRC Antibody

Target Information

Target Protein: Stereocilin
Target Gene: STRC
Alternative Gene Name: DFNB16

Product Description

Polyclonal antibody against human STRC (stereocilin). Recommended for immunohistochemistry and other research applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000014845 (87%)
Mouse ENSMUSG00000033498 (86%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as ligand
Recommended Applications	Immunohistochemistry (IHC) and related assays
Safety Information	Material Safety Data Sheet