
Atlas Antibodies Anti-STK38L Antibody
인간 STK38L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤과 PBS 완충액에 보존되어 안정적입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STK38L Antibody
Target Protein: Serine/threonine kinase 38 like (STK38L)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human STK38L, a serine/threonine kinase involved in various cellular signaling pathways.
Alternative Gene Names
KIAA0965, NDR2
Target Information
| 항목 | 내용 |
|---|---|
| Target Gene | STK38L |
| Target Protein | Serine/threonine kinase 38 like |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (95%), Rat (95%) |
Antigen Information
Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Related Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STK38L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK36 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK38L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK35 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK36 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|