CacheBy
Atlas Antibodies Anti-STK35 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STK35 Antibody

상품 한눈에 보기

인간 STK35 단백질을 인식하는 폴리클로날 항체로, 세린/트레오닌 키나아제 35 연구에 적합. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성이 검증되었고, 마우스 및 랫과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051673-100 Anti-STK35 Antibody, serine/threonine kinase 35 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051673-25 Anti-STK35 Antibody, serine/threonine kinase 35 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STK35 Antibody

Anti-STK35 Antibody

Target Information

  • Target Protein: Serine/threonine kinase 35
  • Target Gene: STK35
  • Alternative Gene Names: bA550O8.2, CLIK1

Product Description

Polyclonal antibody against human STK35.
This antibody is designed for research use in studying serine/threonine kinase 35.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse: ENSMUSG00000037885 (97%)
  • Rat: ENSRNOG00000006002 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

ICC (Immunocytochemistry)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.