Atlas Antibodies Anti-STK24 Antibody

상품 한눈에 보기

Human STK24 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB에 독립적 검증 완료. MST3/MST3B 등 다양한 유전자명과 대응. 고순도 Affinity 정제 및 높은 종간 반응성(인간, 마우스, 랫트). 안정한 PBS/glycerol buffer 포맷.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026502-100 Anti-STK24 Antibody, serine/threonine kinase 24 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026502-25 Anti-STK24 Antibody, serine/threonine kinase 24 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-STK24 Antibody

Anti-STK24 Antibody

Target: Serine/threonine kinase 24
Supplier: Atlas Antibodies

Recommended Applications

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human STK24

Alternative Gene Names

MST-3, MST3, MST3B, STE20, STK3

Open Datasheet

Target Information

항목	내용
Target Protein	Serine/threonine kinase 24
Target Gene	STK24
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Mouse ENSMUSG00000063410 (100%), Rat ENSRNOG00000011511 (100%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand