
Atlas Antibodies Anti-STK24 Antibody
상품 한눈에 보기
Human STK24 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB에 독립적 검증 완료. MST3/MST3B 등 다양한 유전자명과 대응. 고순도 Affinity 정제 및 높은 종간 반응성(인간, 마우스, 랫트). 안정한 PBS/glycerol buffer 포맷.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STK24 Antibody
Target: Serine/threonine kinase 24
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human STK24
Alternative Gene Names
MST-3, MST3, MST3B, STE20, STK3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Serine/threonine kinase 24 |
| Target Gene | STK24 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000063410 (100%), Rat ENSRNOG00000011511 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STK32A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK31 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK24 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.