Atlas Antibodies Anti-STK24 Antibody

상품 한눈에 보기

Human STK24 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립 항체 비교를 통한 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026435-100 Anti-STK24 Antibody, serine/threonine kinase 24 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026435-25 Anti-STK24 Antibody, serine/threonine kinase 24 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Serine/threonine kinase 24 (STK24)
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human STK24.

MST-3, MST3, MST3B, STE20, STK3

항목	내용
Target Protein	Serine/threonine kinase 24
Target Gene	STK24
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Mouse ENSMUSG00000063410 (100%), Rat ENSRNOG00000011511 (100%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.