
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-STK11IP Antibody
상품 한눈에 보기
인간 STK11IP 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 동일성으로 Rat과 Mouse에서도 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036837-100 Anti-STK11IP Antibody, serine/threonine kinase 11 interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036837-25 Anti-STK11IP Antibody, serine/threonine kinase 11 interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-STK11IP Antibody
Anti-STK11IP Antibody
Target: Serine/threonine kinase 11 interacting protein (STK11IP)
Type: Polyclonal Antibody against Human STK11IP
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Alternative Gene Names
KIAA1898, LIP1, LKB1IP, STK11IP1
Target Information
- Target Protein: Serine/threonine kinase 11 interacting protein
- Target Gene: STK11IP
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TPTLQQLNHVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHC
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000020107 | 88% |
| Mouse | ENSMUSG00000026213 | 88% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



