
Atlas Antibodies Anti-STK11IP Antibody
상품 한눈에 보기
인간 STK11IP 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 동일성으로 Rat과 Mouse에서도 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STK11IP Antibody
Target: Serine/threonine kinase 11 interacting protein (STK11IP)
Type: Polyclonal Antibody against Human STK11IP
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Alternative Gene Names
KIAA1898, LIP1, LKB1IP, STK11IP1
Target Information
- Target Protein: Serine/threonine kinase 11 interacting protein
- Target Gene: STK11IP
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TPTLQQLNHVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHC
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000020107 | 88% |
| Mouse | ENSMUSG00000026213 | 88% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STK11IP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK11IP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK11IP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STK11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.