
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-STK11IP Antibody
상품 한눈에 보기
인간 STK11IP 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원을 이용한 친화 정제 방식으로 제조되었습니다. 인간에 대한 반응성이 검증되었으며, 안정한 PBS/glycerol 버퍼에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053192-100 Anti-STK11IP Antibody, serine/threonine kinase 11 interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053192-25 Anti-STK11IP Antibody, serine/threonine kinase 11 interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-STK11IP Antibody
Anti-STK11IP Antibody
Target: Serine/threonine kinase 11 interacting protein (STK11IP)
Type: Polyclonal Antibody against Human STK11IP
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting human STK11IP, developed in rabbit and affinity-purified using the PrEST antigen.
Alternative Gene Names
KIAA1898, LIP1, LKB1IP, STK11IP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Serine/threonine kinase 11 interacting protein |
| Target Gene | STK11IP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TPTLQQLNHVFELHLGPWGPGQTGFVALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPLHC |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (88%), Mouse (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



