
Atlas Antibodies Anti-SPTLC1 Antibody
상품 한눈에 보기
Human SPTLC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 특이성과 검증된 독립적 항체 비교를 통해 신뢰성 있는 단백질 발현 분석이 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPTLC1 Antibody
Target: serine palmitoyltransferase, long chain base subunit 1 (SPTLC1)
Type: Polyclonal Antibody against Human SPTLC1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human SPTLC1.
Alternative Gene Names
hLCB1, HSAN1, HSN1, LCB1, SPTI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | serine palmitoyltransferase, long chain base subunit 1 |
| Target Gene | SPTLC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (89%), Mouse (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPTBN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTBN5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTLC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTBN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTBN4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.