
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPTLC1 Antibody
상품 한눈에 보기
Human SPTLC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 특이성과 검증된 독립적 항체 비교를 통해 신뢰성 있는 단백질 발현 분석이 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063907-100 Anti-SPTLC1 Antibody, serine palmitoyltransferase, long chain base subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063907-25 Anti-SPTLC1 Antibody, serine palmitoyltransferase, long chain base subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPTLC1 Antibody
Anti-SPTLC1 Antibody
Target: serine palmitoyltransferase, long chain base subunit 1 (SPTLC1)
Type: Polyclonal Antibody against Human SPTLC1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human SPTLC1.
Alternative Gene Names
hLCB1, HSAN1, HSN1, LCB1, SPTI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | serine palmitoyltransferase, long chain base subunit 1 |
| Target Gene | SPTLC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (89%), Mouse (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



