
Atlas Antibodies Anti-SPTBN2 Antibody
상품 한눈에 보기
Human SPTBN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. RNA-seq 데이터 기반 직교 검증을 거쳤으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되었고, 보존용으로 글리세롤과 PBS를 포함합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPTBN2 Antibody
Target: spectrin, beta, non-erythrocytic 2 (SPTBN2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human SPTBN2, validated for IHC and ICC applications.
Alternative Gene Names
- SCA5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | spectrin, beta, non-erythrocytic 2 |
| Target Gene | SPTBN2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | PPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAH |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000058842 | 79% |
| Mouse | ENSMUSG00000067889 | 77% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPTBN5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTLC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTBN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTBN4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPTBN1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.