
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPTBN2 Antibody
상품 한눈에 보기
Human SPTBN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. RNA-seq 데이터 기반 직교 검증을 거쳤으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되었고, 보존용으로 글리세롤과 PBS를 포함합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039293-100 Anti-SPTBN2 Antibody, spectrin, beta, non-erythrocytic 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039293-25 Anti-SPTBN2 Antibody, spectrin, beta, non-erythrocytic 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPTBN2 Antibody
Anti-SPTBN2 Antibody
Target: spectrin, beta, non-erythrocytic 2 (SPTBN2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human SPTBN2, validated for IHC and ICC applications.
Alternative Gene Names
- SCA5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | spectrin, beta, non-erythrocytic 2 |
| Target Gene | SPTBN2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | PPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAH |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000058842 | 79% |
| Mouse | ENSMUSG00000067889 | 77% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



