
Thermo Fisher Scientific KCNJ1 (Kir1.1) Polyclonal Antibody
KCNJ1(Kir1.1) 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot 및 IHC에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. PBS/BSA 완충액에 동결건조 형태로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:200 | - |
| Immunohistochemistry (IHC) | Assay-dependent | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDETDDTQM, corresponding to amino acids 342–391 of rat KCNJ1 (Intracellular, C-terminus) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Reconstitution: 25 µL, 50 µL 또는 0.2 mL의 이중 증류수(DDW)로 재용해합니다. 항체는 실온에서 동결건조 분말 형태로 배송되며, 도착 후 -20°C에 보관해야 합니다. 재용해된 용액은 4°C에서 최대 1주일 보관 가능하며, 장기 보관 시 소량으로 분주하여 -20°C에 보관하십시오. 반복적인 동결 및 해동은 피하십시오. 사용 전 모든 항체 용액은 10,000 × g에서 5분간 원심분리하십시오.
Target Information
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiological responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and likely plays an important role in potassium homeostasis. The encoded protein preferentially allows potassium to flow into a cell rather than out. Mutations in this gene are associated with antenatal Bartter syndrome, characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been identified for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.5 (KCNA5) Polyclonal Antibody, Atto 550
1,303,100원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.3 (KCNA3) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KCNJ1 (Kir1.1) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody
923,800원

Thermo Fisher Scientific
Thermo Fisher Scientific OXGR1/GPR99 Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|