Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody
KV1.6(KCNA6) 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot에 적합. Human, Mouse, Rat 시료 반응. 항원 친화 크로마토그래피 정제, Lyophilized 형태로 제공. 재구성 후 -20°C 보관 권장. 연구용으로만 사용.
- 카탈로그번호
- APC-003-xxxxx (2개 옵션)
- 판매단위
- pk
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody
Applications
- Western Blot (WB): 1:200 dilution
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463–530 of rat KV1.6 (Intracellular, C-terminus) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.3 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA, 5% sucrose |
| Contains | 0.025% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: 50 µL 또는 0.2 mL의 이중 증류수(DDW)로 재구성 (샘플 크기별 상이)
- 항체는 실온에서 동결건조 형태로 배송됨
- 도착 후 -20°C에 보관
- 재구성된 용액은 4°C에서 최대 1주일 보관 가능
- 장기 보관 시 소량으로 분주 후 -20°C에 보관
- 반복적인 동결/해동은 피할 것
- 사용 전 모든 항체 용액은 10000 × g, 5분간 원심분리 권장
Target Information
Potassium channels are a complex class of voltage-gated ion channels with diverse physiological roles including regulation of neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It contains six membrane-spanning domains with a shaker-type repeat in the fourth segment and belongs to the delayed rectifier class. The coding region is intronless and is clustered with genes KCNA1 and KCNA5 on chromosome 12.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.