
Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody
KV1.6(KCNA6) 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot에 적합. Human, Mouse, Rat 시료 반응. 항원 친화 크로마토그래피 정제, Lyophilized 형태로 제공. 재구성 후 -20°C 보관 권장. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 1:200 dilution
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463–530 of rat KV1.6 (Intracellular, C-terminus) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.3 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA, 5% sucrose |
| Contains | 0.025% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: 50 µL 또는 0.2 mL의 이중 증류수(DDW)로 재구성 (샘플 크기별 상이)
- 항체는 실온에서 동결건조 형태로 배송됨
- 도착 후 -20°C에 보관
- 재구성된 용액은 4°C에서 최대 1주일 보관 가능
- 장기 보관 시 소량으로 분주 후 -20°C에 보관
- 반복적인 동결/해동은 피할 것
- 사용 전 모든 항체 용액은 10000 × g, 5분간 원심분리 권장
Target Information
Potassium channels are a complex class of voltage-gated ion channels with diverse physiological roles including regulation of neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It contains six membrane-spanning domains with a shaker-type repeat in the fourth segment and belongs to the delayed rectifier class. The coding region is intronless and is clustered with genes KCNA1 and KCNA5 on chromosome 12.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.3 (KCNA3) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KCNJ1 (Kir1.1) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.6 (KCNA6) Polyclonal Antibody
923,800원

Thermo Fisher Scientific
Thermo Fisher Scientific OXGR1/GPR99 Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Nociceptin Receptor (OPRL1) Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|