
Atlas Antibodies Anti-SPG21 Antibody
상품 한눈에 보기
인간 SPG21 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC 등 다양한 응용에 적합합니다. Rabbit에서 생산된 IgG 형태이며, 높은 종간 반응 특이성을 보입니다. 친화 정제된 고품질 항체로 신경질환 연구에 유용합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPG21 Antibody
Target Information
- Protein: Spastic paraplegia 21 (autosomal recessive, Mast syndrome)
- Gene: SPG21
- Alternative Gene Names: ACP33, BM-019, GL010, MAST
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human SPG21.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000032388 | 95% |
| Rat | ENSRNOG00000015019 | 92% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPHK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPG20 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPG21 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPESP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPG11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.