CacheBy
Atlas Antibodies Anti-SPG11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPG11 Antibody

상품 한눈에 보기

Human SPG11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증되었습니다. 신경 관련 단백질 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040947-100 Anti-SPG11 Antibody, spastic paraplegia 11 (autosomal recessive) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040947-25 Anti-SPG11 Antibody, spastic paraplegia 11 (autosomal recessive) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPG11 Antibody

Anti-SPG11 Antibody

Target Information

  • Target Protein: Spastic paraplegia 11 (autosomal recessive)
  • Target Gene: SPG11
  • Alternative Gene Names: FLJ21439, KIAA1840

Product Description

Polyclonal antibody against human SPG11.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IKFPWKLTDAIDEYDVHENVPKVKESNIWKKLSFEEVIASAILNNKIPEAQTFFRIDSHSAQKLEELIGIGLNLVFDNLKKNNIKEASELLKNMGFDVKGQLLKICFYTT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000033396 73%
Rat ENSRNOG00000021954 68%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.