CacheBy
Atlas Antibodies Anti-SPDYE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPDYE1 Antibody

상품 한눈에 보기

Human SPDYE1 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 WB 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. SPDYE1과 관련된 세포주기 조절 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051750-100 Anti-SPDYE1 Antibody, speedy/RINGO cell cycle regulator family member E1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051750-25 Anti-SPDYE1 Antibody, speedy/RINGO cell cycle regulator family member E1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPDYE1 Antibody

Anti-SPDYE1 Antibody

Target: speedy/RINGO cell cycle regulator family member E1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human SPDYE1, suitable for research on cell cycle regulation.


Alternative Gene Names

  • Ringo1
  • SPDYE
  • WBSCR19

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein speedy/RINGO cell cycle regulator family member E1
Target Gene SPDYE1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000058563 (75%), Mouse ENSMUSG00000039296 (73%)

Epitope Sequence:
SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.