Atlas Antibodies Anti-SPDYE1 Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA051750-100 | - | Atlas Antibodies HPA051750-100 Anti-SPDYE1 Antibody, speedy/RINGO cell cycle regulator family member E1 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | ||
HPA051750-25 | - | Atlas Antibodies HPA051750-25 Anti-SPDYE1 Antibody, speedy/RINGO cell cycle regulator family member E1 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-SPDYE1 Antibody
speedy/RINGO cell cycle regulator family member E1
Recommended Applications
Product Description
Polyclonal Antibody against Human SPDYE1
Alternative Gene Names
Ringo1, SPDYE, WBSCR19
Target Protein
speedy/RINGO cell cycle regulator family member E1
Target Gene
SPDYE1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000058563 (75%)
Mouse ENSMUSG00000039296 (73%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|