Atlas Antibodies Anti-SPDYA Antibody

상품 한눈에 보기

Human SPDYA 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. 세포주기 조절 관련 연구에 적합. 높은 종간 반응성(인간, 마우스, 랫트). PrEST 항원을 이용한 친화 정제 방식. 40% 글리세롤 PBS 버퍼로 안정적 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035162-100 Anti-SPDYA Antibody, speedy/RINGO cell cycle regulator family member A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035162-25 Anti-SPDYA Antibody, speedy/RINGO cell cycle regulator family member A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: speedy/RINGO cell cycle regulator family member A
Supplier: Atlas Antibodies

Polyclonal antibody against human SPDYA, a member of the speedy/RINGO cell cycle regulator family.

Target Protein: speedy/RINGO cell cycle regulator family member A
Target Gene: SPDYA
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000052525	97%
Rat	ENSRNOG00000004534	94%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet