
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SOD1 Antibody
상품 한눈에 보기
인간 SOD1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증된 품질을 제공합니다. Rabbit 유래 IgG이며, siRNA knockdown 및 RNA-seq 데이터 기반의 정합 검증을 거쳤습니다. Human, Mouse, Rat에 반응하며, PrEST 항원을 이용해 정제되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001401-100 Anti-SOD1 Antibody, superoxide dismutase 1, soluble 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001401-25 Anti-SOD1 Antibody, superoxide dismutase 1, soluble 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SOD1 Antibody
Anti-SOD1 Antibody
Target: superoxide dismutase 1, soluble
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal antibody against human SOD1.
Alternative Gene Names
ALS, ALS1, IPOA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | superoxide dismutase 1, soluble |
| Target Gene | SOD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000022982 | 82% |
| Rat | ENSRNOG00000002115 | 81% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Related Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



