
Atlas Antibodies Anti-SOD1 Antibody
상품 한눈에 보기
인간 SOD1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증된 품질을 제공합니다. Rabbit 유래 IgG이며, siRNA knockdown 및 RNA-seq 데이터 기반의 정합 검증을 거쳤습니다. Human, Mouse, Rat에 반응하며, PrEST 항원을 이용해 정제되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SOD1 Antibody
Target: superoxide dismutase 1, soluble
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal antibody against human SOD1.
Alternative Gene Names
ALS, ALS1, IPOA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | superoxide dismutase 1, soluble |
| Target Gene | SOD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000022982 | 82% |
| Rat | ENSRNOG00000002115 | 81% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Related Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
