CacheBy
Atlas Antibodies Anti-SOD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SOD2 Antibody

상품 한눈에 보기

Human SOD2 단백질에 대한 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. Affinity purification으로 높은 특이성과 재현성 확보. Human, Mouse, Rat에서 반응 확인. 40% glycerol 기반 buffer로 안정성 유지.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001814-100 Anti-SOD2 Antibody, superoxide dismutase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001814-25 Anti-SOD2 Antibody, superoxide dismutase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SOD2 Antibody

Anti-SOD2 Antibody

Target: superoxide dismutase 2, mitochondrial

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human SOD2
Open Datasheet

Target Information

  • Target Protein: superoxide dismutase 2, mitochondrial
  • Target Gene: SOD2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000006818 (88%)
  • Rat ENSRNOG00000019048 (87%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도 및 조건은 사용자가 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.