
Atlas Antibodies Anti-SNF8 Antibody
상품 한눈에 보기
Human SNF8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합. SNF8은 ESCRT-II 복합체의 하위 단위로 세포 내 단백질 수송에 관여. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SNF8 Antibody
Target: SNF8, ESCRT-II complex subunit
Type: Polyclonal Antibody against Human SNF8
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human SNF8 protein, a subunit of the ESCRT-II complex involved in intracellular protein sorting.
Alternative Gene Names
Dot3, EAP30, VPS22
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SNF8, ESCRT-II complex subunit |
| Target Gene | SNF8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYL |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000006500 (100%), Mouse ENSMUSG00000006058 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
