Atlas Antibodies Anti-SND1 Antibody

상품 한눈에 보기

Human SND1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 Western Blot에 적합하며 Orthogonal validation으로 검증됨. Human, Mouse, Rat 반응성 확인됨. 친화 정제된 고품질 연구용 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA002632-100 Anti-SND1 Antibody, staphylococcal nuclease and tudor domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA002632-25 Anti-SND1 Antibody, staphylococcal nuclease and tudor domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: staphylococcal nuclease and tudor domain containing 1 (SND1)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Western Blot (WB)

Polyclonal Antibody against Human SND1

p100, TDRD11

항목	내용
Target Protein	staphylococcal nuclease and tudor domain containing 1
Target Gene	SND1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000031173 (100%), Mouse ENSMUSG00000001424 (100%)

Antigen Sequence:
ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand