
Atlas Antibodies Anti-SMIM4 Antibody
Human SMIM4 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 인간 특이성과 재현성 있는 결과 제공. 40% 글리세롤 및 PBS 완충액에 보존됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SMIM4 Antibody
Target: small integral membrane protein 4 (SMIM4)
Type: Polyclonal Antibody against Human SMIM4
Host: Rabbit
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human SMIM4 (small integral membrane protein 4).
Alternative Gene Names: C3orf78
Target Gene: SMIM4
Target Protein: small integral membrane protein 4
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
IKVRVGQETFYDVYRRKASERQYQRRLEDE
Verified Species Reactivity
- Human
Interspecies Information:
| Species | Gene ID | Sequence Identity |
|----------|----------|------------------|
| Mouse | ENSMUSG00000058351 | 97% |
| Rat | ENSRNOG00000033508 | 37% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SMIM5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SMIM7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SMIM4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SMIM24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SMIM5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|