
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SMIM4 Antibody
상품 한눈에 보기
Human SMIM4 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 인간 특이성과 재현성 있는 결과 제공. 40% 글리세롤 및 PBS 완충액에 보존됨.
- 카탈로그번호
- HPA047771-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047771-100 Anti-SMIM4 Antibody, small integral membrane protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047771-25 Anti-SMIM4 Antibody, small integral membrane protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SMIM4 Antibody
Anti-SMIM4 Antibody
Target: small integral membrane protein 4 (SMIM4)
Type: Polyclonal Antibody against Human SMIM4
Host: Rabbit
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human SMIM4 (small integral membrane protein 4).
Alternative Gene Names: C3orf78
Target Gene: SMIM4
Target Protein: small integral membrane protein 4
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
IKVRVGQETFYDVYRRKASERQYQRRLEDE
Verified Species Reactivity
- Human
Interspecies Information:
| Species | Gene ID | Sequence Identity |
|----------|----------|------------------|
| Mouse | ENSMUSG00000058351 | 97% |
| Rat | ENSRNOG00000033508 | 37% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



