
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SMIM24 Antibody
상품 한눈에 보기
Human SMIM24 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교 확인함. Affinity 정제 방식으로 높은 특이성과 재현성을 제공하며, 다양한 조직 연구에 적합함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA056027-100 Anti-SMIM24 Antibody, small integral membrane protein 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056027-25 Anti-SMIM24 Antibody, small integral membrane protein 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SMIM24 Antibody
Anti-SMIM24 Antibody
Target: small integral membrane protein 24 (SMIM24)
Validated Application: IHC Orthogonal validation using RNA-seq comparison data.
Product Description
Polyclonal antibody against human SMIM24, providing reliable detection of small integral membrane protein 24.
Alternative Gene Names
C19orf77, HSPC323
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | small integral membrane protein 24 |
| Target Gene | SMIM24 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NRLWCSKARAEDEEETTFRMESNLYQDQSEDKREKKEAKEKEEKRKKE |
Species Reactivity
| Verified Species | Human |
|---|---|
| Mouse Ortholog | ENSMUSG00000078439 (44%) |
| Rat Ortholog | ENSRNOG00000048878 (44%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



