
Atlas Antibodies Anti-FGL2 Antibody
상품 한눈에 보기
인간 FGL2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. RNA-seq 데이터 기반 정교한 직교 검증 수행. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성을 보장. 다양한 조직 발현 연구에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FGL2 Antibody
Target: fibrinogen-like 2 (FGL2)
Type: Polyclonal Antibody against Human FGL2
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody raised in rabbit against human fibrinogen-like 2 (FGL2).
Alternative Gene Names
pT49, T49
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | fibrinogen-like 2 |
| Target Gene | FGL2 |
| Antigen Sequence | RNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012881 (68%), Mouse ENSMUSG00000039899 (67%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
