CacheBy
Atlas Antibodies Anti-FH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FH Antibody

상품 한눈에 보기

Human FH 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증으로 신뢰성 확보. 고순도 친화 정제 방식으로 제조되어 재현성 높은 결과 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA025948-100 Anti-FH Antibody, fumarate hydratase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025948-25 Anti-FH Antibody, fumarate hydratase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FH Antibody

Anti-FH Antibody

Target: fumarate hydratase (FH)

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent Validation)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human FH (fumarate hydratase).

Alternative Gene Names

  • fumarase

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein fumarate hydratase
Target Gene FH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPK
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000003653 (100%), Mouse ENSMUSG00000026526 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.