Atlas Antibodies Anti-FCAMR Antibody
상품 한눈에 보기
인체 FCAMR 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, RNA-seq 기반 정교한 Orthogonal 검증을 거쳤습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FCAMR Antibody
Fc fragment of IgA and IgM receptor
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human FCAMR.
Alternative Gene Names
CD351, FCA/MR, FKSG87
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Fc fragment of IgA and IgM receptor |
| Target Gene | FCAMR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HPRWLWEGSLPSRTHLRAMGTLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYA |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000026415 (50%) Rat ENSRNOG00000004393 (47%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.