CacheBy
Atlas Antibodies Anti-FCAMR Antibody
원본

Atlas Antibodies Anti-FCAMR Antibody

상품 한눈에 보기

인체 FCAMR 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, RNA-seq 기반 정교한 Orthogonal 검증을 거쳤습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056505-100 Anti-FCAMR Antibody, Fc fragment of IgA and IgM receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056505-25 Anti-FCAMR Antibody, Fc fragment of IgA and IgM receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FCAMR Antibody

Anti-FCAMR Antibody

Fc fragment of IgA and IgM receptor


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human FCAMR.


Alternative Gene Names

CD351, FCA/MR, FKSG87

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Fc fragment of IgA and IgM receptor
Target Gene FCAMR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HPRWLWEGSLPSRTHLRAMGTLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYA

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026415 (50%)
Rat ENSRNOG00000004393 (47%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.