CacheBy
Atlas Antibodies Anti-FBXW8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FBXW8 Antibody

상품 한눈에 보기

Human FBXW8 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공. Human에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038851-100 Anti-FBXW8 Antibody, F-box and WD repeat domain containing 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038851-25 Anti-FBXW8 Antibody, F-box and WD repeat domain containing 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FBXW8 Antibody

Anti-FBXW8 Antibody

F-box and WD repeat domain containing 8

면역조직화학(IHC) 등 다양한 연구 응용에 적합

Product Description

Polyclonal Antibody against Human FBXW8

Alternative Gene Names

FBW6, FBW8, FBX29, FBXO29

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein F-box and WD repeat domain containing 8
Target Gene FBXW8
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000032867 (78%), Rat ENSRNOG00000001126 (77%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 따라 설정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.