CacheBy
Atlas Antibodies Anti-FAM213B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FAM213B Antibody

상품 한눈에 보기

Human FAM213B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. C1orf93, MGC26818 대체 유전자명으로도 알려져 있으며, Human 및 Mouse 반응성이 검증되었습니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006403-100 Anti-FAM213B Antibody, family with sequence similarity 213, member B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006403-25 Anti-FAM213B Antibody, family with sequence similarity 213, member B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FAM213B Antibody

Anti-FAM213B Antibody

family with sequence similarity 213, member B


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human FAM213B.


Alternative Gene Names

C1orf93, MGC26818

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein family with sequence similarity 213, member B
Target Gene FAM213B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKS

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000029059 (92%)
  • Rat ENSRNOG00000013468 (89%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.