
Atlas Antibodies Anti-FAM213B Antibody
Human FAM213B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. C1orf93, MGC26818 대체 유전자명으로도 알려져 있으며, Human 및 Mouse 반응성이 검증되었습니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FAM213B Antibody
family with sequence similarity 213, member B
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human FAM213B.
Alternative Gene Names
C1orf93, MGC26818
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | family with sequence similarity 213, member B |
| Target Gene | FAM213B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKS |
Verified Species Reactivity
- Human
- Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000029059 (92%)
- Rat ENSRNOG00000013468 (89%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FAM214A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM212A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM213B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM213A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM213A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|