
Atlas Antibodies Anti-FAM213A Antibody
상품 한눈에 보기
Human FAM213A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. 고순도 Affinity 정제 방식으로 제조되었으며 Human 및 Rat에 반응합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FAM213A Antibody
Target: family with sequence similarity 213, member A (FAM213A)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human FAM213A
Alternative Gene Names
C10orf58, MGC4248, PAMM
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | family with sequence similarity 213, member A |
| Target Gene | FAM213A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGE |
| Verified Species Reactivity | Human, Rat |
| Interspecies Information | Rat ENSRNOG00000011140 (89%), Mouse ENSMUSG00000021792 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FAM213B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM213A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM213A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM214A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM210B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.