
원본
Thermo Fisher Scientific RICH2 Polyclonal Antibody
상품 한눈에 보기
RICH2 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot, IHC, ELISA, IP에 사용 가능. 인간, 생쥐, 랫트 반응성. 고순도 친화 크로마토그래피 정제, -20°C 보관. 연구용 전용.
- 카탈로그번호
- RICH2-201AP
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 09:45
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific RICH2-201AP RICH2 Polyclonal Antibody 200 ul pk판매 단위 pk ·
재고 확인 필요
449,700원VAT 포함 494,670원
Thermo Fisher Scientific · Thermo Fisher Scientific RICH2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminal amino acids 1–60 of Mouse RICH2. Sequence: MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGA |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
RICH2는 GTPase-activating protein (GAP)으로, Rho-type GTPases의 GTPase 활성을 자극하여 이들의 활성(GTP-bound)과 비활성(GDP-bound) 상태 간 전환을 조절합니다. 특히 CDC42 및 RAC1에 대해 GAP 활성을 가지며, 뉴런에서 수상돌기 가시 형성과 시냅스 가소성에 관여합니다. RAC1-GAP 활성을 통해 필로포디아 형성을 제한하며, SHANK3와의 상호작용을 통해 GRIA1의 재활용 엔도좀에서의 외포작용과 장기 강화(LTP) 관련 가시 형태 변화를 촉진합니다.
[UniProt]
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
