Thermo Fisher Scientific Aquaporin 4 Polyclonal Antibody
Rabbit polyclonal antibody against Aquaporin 4 for WB, IHC(F), and ICC/IF applications. Lyophilized form, reconstitutable with deionized water. Suitable for detecting AQP4 in muscle and other tissues. For research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:200–1:500 | - |
| Immunohistochemistry (Frozen) (IHC (F)) | Assay-dependent | - |
| Immunocytochemistry (ICC/IF) | Assay-dependent | - |
Product Specifications
| Property | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249–323 of rat AQP4 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Storage Conditions | -20 °C |
| Shipping Conditions | Wet ice |
| RRID | AB_2735468 |
Product Specific Information
- Shipped at room temperature as a lyophilized powder.
- Store at -20 °C upon receipt.
- Reconstitution: Add 50 µL of deionized water.
Target Information
Aquaporin 4 (AQP4), also known as mercurial-insensitive water channel, localizes to the sarcolemma of fast-twitch muscle fibers in skeletal muscle.
Aquaporins (AQPs) are integral membrane water transport channel proteins that facilitate water movement across cell membranes, a function conserved across animals, plants, and bacteria.
Mammalian aquaporins include isoforms AQP0 through AQP10, often co-expressed within the same cell.
While most AQPs are selective for water, AQP3, AQP7, AQP9, and one transcript of AQP10 also transport urea and glycerol.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 6 Polyclonal Antibody
949,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 2 Polyclonal Antibody
949,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 4 Polyclonal Antibody
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 5 Polyclonal Antibody
949,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 1 Polyclonal Antibody
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|