Thermo Fisher Scientific Aquaporin 4 Polyclonal Antibody
Rabbit polyclonal antibody against Aquaporin 4 for WB, IHC(F), and ICC/IF applications. Lyophilized form, reconstitutable with deionized water. Suitable for detecting AQP4 in muscle and other tissues. For research use only.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Aquaporin 4 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:200–1:500 | - |
| Immunohistochemistry (Frozen) (IHC (F)) | Assay-dependent | - |
| Immunocytochemistry (ICC/IF) | Assay-dependent | - |
Product Specifications
| Property | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249–323 of rat AQP4 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Storage Conditions | -20 °C |
| Shipping Conditions | Wet ice |
| RRID | AB_2735468 |
Product Specific Information
- Shipped at room temperature as a lyophilized powder.
- Store at -20 °C upon receipt.
- Reconstitution: Add 50 µL of deionized water.
Target Information
Aquaporin 4 (AQP4), also known as mercurial-insensitive water channel, localizes to the sarcolemma of fast-twitch muscle fibers in skeletal muscle.
Aquaporins (AQPs) are integral membrane water transport channel proteins that facilitate water movement across cell membranes, a function conserved across animals, plants, and bacteria.
Mammalian aquaporins include isoforms AQP0 through AQP10, often co-expressed within the same cell.
While most AQPs are selective for water, AQP3, AQP7, AQP9, and one transcript of AQP10 also transport urea and glycerol.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.