Thermo Fisher Scientific Annexin A4 Polyclonal Antibody
Annexin A4 단백질을 인식하는 토끼 폴리클로날 항체. Western blot, IHC(P), Flow cytometry에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119–152aa: EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745897 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are not fully defined, several annexins are implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 shares 45–59% identity with other annexins and has a similar exon–intron organization. Isolated from human placenta, ANX4 encodes a protein that may interact with ATP, exhibits in vitro anticoagulant activity, and inhibits phospholipase A2 activity. ANX4 is predominantly expressed in epithelial cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin V Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin A4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin A4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin VII Polyclonal Antibody
514,100원
Thermo Fisher Scientific
Thermo Fisher Scientific DOG-1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|