Thermo Fisher Scientific Annexin VII Polyclonal Antibody
Rabbit polyclonal antibody targeting human Annexin VII for research use. Suitable for Western blot applications. Lyophilized form, reconstitutes to 500 µg/mL. Unconjugated and stored at -20°C. Promotes membrane fusion and exocytosis studies.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific Annexin VII Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745901 |
Product Specific Information
The synthetic peptide sequence is 434–466aa: TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL.
Add 0.2 mL of distilled water to reconstitute, yielding a concentration of 500 µg/mL.
Target Information
Annexin VII is a calcium/phospholipid-binding protein that promotes membrane fusion and is involved in exocytosis. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately the full coding region for this protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin A4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin A4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin VII Polyclonal Antibody
514,100원
Thermo Fisher Scientific
Thermo Fisher Scientific DOG-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Annexin A3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|