Thermo Fisher Scientific Annexin VII Polyclonal Antibody
Rabbit polyclonal antibody targeting human Annexin VII for research use. Suitable for Western blot applications. Lyophilized form, reconstitutes to 500 µg/mL. Unconjugated and stored at -20°C. Promotes membrane fusion and exocytosis studies.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Annexin VII Polyclonal Antibody
Thermo Fisher Scientific Annexin VII Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745901 |
Product Specific Information
The synthetic peptide sequence is 434–466aa: TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL.
Add 0.2 mL of distilled water to reconstitute, yielding a concentration of 500 µg/mL.
Target Information
Annexin VII is a calcium/phospholipid-binding protein that promotes membrane fusion and is involved in exocytosis. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately the full coding region for this protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.