Thermo Fisher Scientific TSPYL1 Polyclonal Antibody
TSPYL1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot, IHC, ELISA, IP 등에 사용 가능. 인간 시료 반응성, 액상 형태, Affinity Chromatography로 정제됨. 연구용으로만 사용.
- 카탈로그번호
- PA588398
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific TSPYL1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:100–1:500 |
| ELISA | 1 µg/mL |
| Immunoprecipitation (IP) | 0.5 µg–4 µg antibody for 200 µg–400 µg extracts |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1–230 of human TSPYL1 (NP_003300.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 4.31 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | –20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2804881 |
Product Specific Information
Immunogen sequence:
MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALPPPPPSEEGGVPQDAAGRGGTPQIRVVGGRGHVAIKAGQEEGQPPAEGLAAASVVMAADRS LKKGVQGGEKALEICGAQRSASELTAGAEA EAEEVKTGKCATVSAAVAERESAEVVKEGLAEKEVMEEQMEVEEQPPEGE EIEVAEEDRLEEEAREEEGPWPLHEALRMD
Positive Samples: U-87MG, SKOV3, LO2, HeLa, 293T, A-549
Cellular Location: Nucleus, nucleolus
Target Information
The protein encoded by this gene is found in the nucleolus and is similar to a family of genes on the Y-chromosome. This gene is intronless. Defects in this gene are associated with sudden infant death with dysgenesis of the testes syndrome (SIDDT).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.