Thermo Fisher Scientific TSPYL1 Polyclonal Antibody
TSPYL1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot, IHC, ELISA, IP 등에 사용 가능. 인간 시료 반응성, 액상 형태, Affinity Chromatography로 정제됨. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:100–1:500 |
| ELISA | 1 µg/mL |
| Immunoprecipitation (IP) | 0.5 µg–4 µg antibody for 200 µg–400 µg extracts |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1–230 of human TSPYL1 (NP_003300.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 4.31 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | –20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2804881 |
Product Specific Information
Immunogen sequence:
MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALPPPPPSEEGGVPQDAAGRGGTPQIRVVGGRGHVAIKAGQEEGQPPAEGLAAASVVMAADRS LKKGVQGGEKALEICGAQRSASELTAGAEA EAEEVKTGKCATVSAAVAERESAEVVKEGLAEKEVMEEQMEVEEQPPEGE EIEVAEEDRLEEEAREEEGPWPLHEALRMD
Positive Samples: U-87MG, SKOV3, LO2, HeLa, 293T, A-549
Cellular Location: Nucleus, nucleolus
Target Information
The protein encoded by this gene is found in the nucleolus and is similar to a family of genes on the Y-chromosome. This gene is intronless. Defects in this gene are associated with sudden infant death with dysgenesis of the testes syndrome (SIDDT).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific FAU Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific AGTRAP Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific TSPYL1 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific CDH11 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific OSTF1 Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|