Thermo Fisher Scientific Keratocan Polyclonal Antibody
Keratocan 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western blot과 Flow Cytometry에 적합합니다. Human과 Mouse 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Keratocan Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Flow Cytometry (Flow) | - | 1 publication |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77–109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746667 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein encoded by the KERA gene in humans, mapped to chromosome 12q22. This protein is a keratan sulfate proteoglycan involved in maintaining corneal transparency.
Defects in the KERA gene are associated with autosomal recessive cornea plana 2 (CNA2).
Keratan sulfate proteoglycans (KSPGs), including keratocan, lumican, and mimecan, belong to the small leucine-rich proteoglycan (SLRP) family and are crucial for corneal transparency.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.