Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
Thermo Fisher Scientific의 KV1.4 (KCNA4) 폴리클로날 항체는 인간 시료에서 반응하며, Western blot 및 IHC(P) 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 재구성 시 500 µg/mL 농도로 사용 가능합니다. 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609–647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746665 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Potassium voltage-gated channel subfamily A member 4 (Kv1.4, also known as PCN2) is encoded by the KCNA4 gene in humans.
This gene encodes a member of the voltage-gated potassium channel family, mapped to chromosome 11p14.1.
KCNA4 contributes to the A-type potassium current, which regulates the fast repolarizing phase of cardiac action potentials and influences their duration.
It also contributes to the cardiac transient outward potassium current (Ito1), a key component of the repolarizing phase 1 of the cardiac action potential.
Known interacting partners include DLG4, KCNA2, and DLG1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CIP2A Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific KV2.1 (KCNB1) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Keratocan Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GCN5 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|