Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
Thermo Fisher Scientific의 KV1.4 (KCNA4) 폴리클로날 항체는 인간 시료에서 반응하며, Western blot 및 IHC(P) 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 재구성 시 500 µg/mL 농도로 사용 가능합니다. 연구용으로만 사용됩니다.
- 카탈로그번호
- PA579550
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific KV1.4 (KCNA4) Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609–647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746665 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Potassium voltage-gated channel subfamily A member 4 (Kv1.4, also known as PCN2) is encoded by the KCNA4 gene in humans.
This gene encodes a member of the voltage-gated potassium channel family, mapped to chromosome 11p14.1.
KCNA4 contributes to the A-type potassium current, which regulates the fast repolarizing phase of cardiac action potentials and influences their duration.
It also contributes to the cardiac transient outward potassium current (Ito1), a key component of the repolarizing phase 1 of the cardiac action potential.
Known interacting partners include DLG4, KCNA2, and DLG1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.