CacheBy
Atlas Antibodies Anti-FAHD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FAHD1 Antibody

상품 한눈에 보기

FAHD1 단백질을 인식하는 인체 유래 폴리클로날 항체. IHC 및 WB 검증 완료. Rabbit IgG 형식으로 제작되었으며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043226-100 Anti-FAHD1 Antibody, fumarylacetoacetate hydrolase domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043226-25 Anti-FAHD1 Antibody, fumarylacetoacetate hydrolase domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FAHD1 Antibody

Anti-FAHD1 Antibody

fumarylacetoacetate hydrolase domain containing 1


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Independent Validation
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human FAHD1


Alternative Gene Names

C16orf36, DKFZP566J2046

Open Datasheet


Target Information

항목 내용
Target Protein fumarylacetoacetate hydrolase domain containing 1
Target Gene FAHD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014727 (84%), Mouse ENSMUSG00000045316 (84%)

Antigen Sequence:
MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARD


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.