
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FAHD1 Antibody
상품 한눈에 보기
FAHD1 단백질을 인식하는 인체 유래 폴리클로날 항체. IHC 및 WB 검증 완료. Rabbit IgG 형식으로 제작되었으며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫과 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043226-100 Anti-FAHD1 Antibody, fumarylacetoacetate hydrolase domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043226-25 Anti-FAHD1 Antibody, fumarylacetoacetate hydrolase domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FAHD1 Antibody
Anti-FAHD1 Antibody
fumarylacetoacetate hydrolase domain containing 1
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human FAHD1
Alternative Gene Names
C16orf36, DKFZP566J2046
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | fumarylacetoacetate hydrolase domain containing 1 |
| Target Gene | FAHD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000014727 (84%), Mouse ENSMUSG00000045316 (84%) |
Antigen Sequence:
MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



