AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FAIM2 Antibody
상품 한눈에 보기
FAIM2 단백질을 인식하는 토끼 폴리클로날 항체로, 인간 시료에 적합합니다. IHC 등 단백질 발현 검증에 활용되며, RNA-seq 데이터와의 정합 검증(Orthogonal validation)을 거쳤습니다. PrEST 항원을 이용해 친화 정제되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018790-100 Anti-FAIM2 Antibody, Fas apoptotic inhibitory molecule 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018790-25 Anti-FAIM2 Antibody, Fas apoptotic inhibitory molecule 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FAIM2 Antibody
Anti-FAIM2 Antibody
Fas apoptotic inhibitory molecule 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human FAIM2
Alternative Gene Names
KIAA0950, LFG, LFG2, LIFEGUARD, NMP35, TMBIM2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Fas apoptotic inhibitory molecule 2 |
| Target Gene | FAIM2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE |
| Verified Species Reactivity | Human |
| Interspecies Information | Highest antigen sequence identity: Rat ENSRNOG00000053258 (93%) Mouse ENSMUSG00000023011 (91%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.