
Atlas Antibodies Anti-ERP27 Antibody
상품 한눈에 보기
Human ERP27 단백질을 표적하는 폴리클로날 토끼 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 재조합 발현 기반 검증을 통해 높은 특이성과 신뢰성을 제공. Affinity purification 방식으로 정제되어 다양한 연구 응용에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ERP27 Antibody
Target: Endoplasmic Reticulum Protein 27 (ERP27)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Recombinant Expression Validation): Validation using target protein overexpression.
Product Description
Polyclonal antibody against human ERP27.
Alternative Gene Names
C12orf46, ERp27, FLJ32115, PDIA8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Endoplasmic Reticulum Protein 27 |
| Target Gene | ERP27 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (66%), Rat (57%) |
Antigen Sequence:
ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet
Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
