
Atlas Antibodies Anti-ERLEC1 Antibody
상품 한눈에 보기
인간 ERLEC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합. Rabbit IgG 형식으로 높은 특이성과 재현성을 제공. PrEST 항원으로 친화 정제되어 높은 순도 확보. Human 및 Mouse 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ERLEC1 Antibody
Target: Endoplasmic Reticulum Lectin 1 (ERLEC1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Suitable for detection of ERLEC1 protein.
Product Description
Polyclonal antibody against human ERLEC1.
Alternative Gene Names
C2orf30, CL25084, ERLECTIN, XTP3-B, XTP3TPB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Endoplasmic Reticulum Lectin 1 |
| Target Gene | ERLEC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Information | Rat ENSRNOG00000007283 (94%), Mouse ENSMUSG00000020311 (94%) |
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ERMP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERMP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERLEC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERMN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERLIN2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.