CacheBy
Atlas Antibodies Anti-ERLEC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ERLEC1 Antibody

상품 한눈에 보기

인간 ERLEC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합. Rabbit IgG 형식으로 높은 특이성과 재현성을 제공. PrEST 항원으로 친화 정제되어 높은 순도 확보. Human 및 Mouse 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031502-100 Anti-ERLEC1 Antibody, endoplasmic reticulum lectin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031502-25 Anti-ERLEC1 Antibody, endoplasmic reticulum lectin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ERLEC1 Antibody

Anti-ERLEC1 Antibody

Target: Endoplasmic Reticulum Lectin 1 (ERLEC1)
Supplier: Atlas Antibodies


  • IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Suitable for detection of ERLEC1 protein.

Product Description

Polyclonal antibody against human ERLEC1.


Alternative Gene Names

C2orf30, CL25084, ERLECTIN, XTP3-B, XTP3TPB


Target Information

항목 내용
Target Protein Endoplasmic Reticulum Lectin 1
Target Gene ERLEC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE
Verified Species Reactivity Human, Mouse
Interspecies Information Rat ENSRNOG00000007283 (94%), Mouse ENSMUSG00000020311 (94%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.