
원본
Atlas Antibodies Anti-ERMP1 Antibody
상품 한눈에 보기
Human ERMP1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대해 검증된 반응성을 가지며, 높은 종간 서열 유사성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020584-100 Anti-ERMP1 Antibody, endoplasmic reticulum metallopeptidase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020584-25 Anti-ERMP1 Antibody, endoplasmic reticulum metallopeptidase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ERMP1 Antibody
Anti-ERMP1 Antibody
Target: Endoplasmic Reticulum Metallopeptidase 1 (ERMP1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ERMP1.
Alternative Gene Names
FLJ23309, FXNA, KIAA1815
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Endoplasmic Reticulum Metallopeptidase 1 |
| Target Gene | ERMP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000010915 (89%), Mouse ENSMUSG00000046324 (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
SSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



