원본

Atlas Antibodies Anti-ERMP1 Antibody

상품 한눈에 보기

Human ERMP1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대해 검증된 반응성을 가지며, 높은 종간 서열 유사성을 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA020584-100 Anti-ERMP1 Antibody, endoplasmic reticulum metallopeptidase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA020584-25 Anti-ERMP1 Antibody, endoplasmic reticulum metallopeptidase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Endoplasmic Reticulum Metallopeptidase 1 (ERMP1)
Supplier: Atlas Antibodies

Polyclonal antibody against human ERMP1.

FLJ23309, FXNA, KIAA1815

항목	내용
Target Protein	Endoplasmic Reticulum Metallopeptidase 1
Target Gene	ERMP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000010915 (89%), Mouse ENSMUSG00000046324 (89%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

SSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPV

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

IHC Application
ICC Application

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.