
Atlas Antibodies Anti-ERMN Antibody
상품 한눈에 보기
인간 ERMN 단백질을 표적으로 하는 폴리클로날 항체로, IHC와 WB에서 검증된 고품질 제품입니다. Rabbit에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 인간에 반응하며, orthogonal 및 recombinant expression validation 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ERMN Antibody
Target Protein: ermin, ERM-like protein
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): 비교 대상 조직의 RNA-seq 데이터로 단백질 발현을 교차 검증
- Recombinant expression validation (WB): 표적 단백질 과발현을 이용한 재조합 발현 검증
Product Description
Polyclonal antibody against human ERMN.
Alternative Gene Names
ERMIN, JN, KIAA1189
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | ermin, ERM-like protein |
| Target Gene | ERMN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRK |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000021472 (69%), Mouse ENSMUSG00000026830 (66%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ERLEC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERMAP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERMN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERMAP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ERICH5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.