
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ERLEC1 Antibody
상품 한눈에 보기
인간 ERLEC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간과 마우스에 반응하며 높은 종간 서열 유사성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031503-100 Anti-ERLEC1 Antibody, endoplasmic reticulum lectin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031503-25 Anti-ERLEC1 Antibody, endoplasmic reticulum lectin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ERLEC1 Antibody
Anti-ERLEC1 Antibody
Target: Endoplasmic Reticulum Lectin 1 (ERLEC1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Product Description
Polyclonal antibody against human ERLEC1.
Alternative Gene Names
C2orf30, CL25084, ERLECTIN, XTP3-B, XTP3TPB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Endoplasmic Reticulum Lectin 1 |
| Target Gene | ERLEC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE |
Species Reactivity
- Verified: Human, Mouse
- Interspecies Information:
- Rat ENSRNOG00000007283 (94%)
- Mouse ENSMUSG00000020311 (94%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



