CacheBy
Atlas Antibodies Anti-ERBB4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ERBB4 Antibody

상품 한눈에 보기

Human ERBB4 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교하여 확인 가능. PrEST 항원을 이용해 Affinity Purified 되었으며, Human 시료에 높은 특이성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012016-100 Anti-ERBB4 Antibody, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012016-25 Anti-ERBB4 Antibody, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ERBB4 Antibody

Anti-ERBB4 Antibody

Target: v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4
Type: Polyclonal Antibody against Human ERBB4
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human ERBB4, validated for orthogonal IHC applications.


Alternative Gene Names

ALS19

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4
Target Gene ERBB4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000062209 (91%), Rat ENSRNOG00000014248 (79%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.