
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ERC1 Antibody
상품 한눈에 보기
Human ERC1 단백질을 타겟으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG로 Affinity purification 수행. Human, Mouse, Rat 종에 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019513-100 Anti-ERC1 Antibody, ELKS/RAB6-interacting/CAST family member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019513-25 Anti-ERC1 Antibody, ELKS/RAB6-interacting/CAST family member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ERC1 Antibody
Anti-ERC1 Antibody
ELKS/RAB6-interacting/CAST family member 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Independent validation comparing antibodies targeting different epitopes of the protein
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human ERC1
Alternative Gene Names
CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ELKS/RAB6-interacting/CAST family member 1 |
| Target Gene | ERC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPD |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000009264 (89%)
- Mouse ENSMUSG00000030172 (89%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



