CacheBy
Atlas Antibodies Anti-ERC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ERC1 Antibody

상품 한눈에 보기

Human ERC1 단백질을 타겟으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG로 Affinity purification 수행. Human, Mouse, Rat 종에 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019513-100 Anti-ERC1 Antibody, ELKS/RAB6-interacting/CAST family member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019513-25 Anti-ERC1 Antibody, ELKS/RAB6-interacting/CAST family member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ERC1 Antibody

Anti-ERC1 Antibody

ELKS/RAB6-interacting/CAST family member 1


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Independent validation comparing antibodies targeting different epitopes of the protein
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human ERC1


Alternative Gene Names

CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2

Open Datasheet


Target Information

항목 내용
Target Protein ELKS/RAB6-interacting/CAST family member 1
Target Gene ERC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence IIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPD

Verified Species Reactivity

Human, Mouse, Rat


Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000009264 (89%)
  • Mouse ENSMUSG00000030172 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.