
Atlas Antibodies Anti-EPS15 Antibody
상품 한눈에 보기
인간 EPS15 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합. Rabbit에서 생산되었으며, PrEST 항원으로 친화 정제됨. 높은 종 간 보존성과 신뢰성 있는 반응성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EPS15 Antibody
Target Information
- Target Protein: Epidermal growth factor receptor pathway substrate 15
- Target Gene: EPS15
- Alternative Gene Names: AF-1P, MLLT5
Product Description
Polyclonal antibody against human EPS15.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Species Reactivity
- Verified Species: Human
- Interspecies Identity:
- Rat ENSRNOG00000010299 (83%)
- Mouse ENSMUSG00000028552 (81%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EPS8L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPS15L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPS15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPRS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPS15 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.