CacheBy
Atlas Antibodies Anti-EPRS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EPRS Antibody

상품 한눈에 보기

인간 EPRS(glutamyl-prolyl-tRNA synthetase)를 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. WB 및 IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 고품질 검증된 데이터와 높은 종간 반응 특성을 제공합니다.

카탈로그번호
HPA030052-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030052-100 Anti-EPRS Antibody, glutamyl-prolyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030052-25 Anti-EPRS Antibody, glutamyl-prolyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EPRS Antibody

Anti-EPRS Antibody

Target Information

  • Target Protein: glutamyl-prolyl-tRNA synthetase
  • Target Gene: EPRS
  • Alternative Gene Names: EARS, GLUPRORS, PARS, QARS, QPRS

Product Description

Polyclonal Antibody against Human EPRS.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    CVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAIL

Species Reactivity

  • Verified Species: Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000026615 86%
Rat ENSRNOG00000002393 83%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Enhanced Validation
IHC Application
WB Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.