
Atlas Antibodies Anti-EPHX3 Antibody
상품 한눈에 보기
Human EPHX3 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합. Affinity purification으로 높은 특이성과 재현성 확보. PBS/glycerol buffer에 보존되어 안정적 사용 가능. Human에 검증된 반응성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EPHX3 Antibody
Target: Epoxide hydrolase 3 (EPHX3)
Type: Polyclonal Antibody against Human EPHX3
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody generated in rabbit against human EPHX3 protein.
Alternative Gene Names
ABHD9, FLJ22408
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Epoxide hydrolase 3 |
| Target Gene | EPHX3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일도 |
|---|---|---|
| Mouse | ENSMUSG00000037577 | 82% |
| Rat | ENSRNOG00000027319 | 80% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EPHX2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPHX4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPHX3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPHX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPHA3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.