
Atlas Antibodies Anti-EPHX1 Antibody
상품 한눈에 보기
Human EPHX1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western blot에 적합. 독립적 및 Orthogonal validation으로 검증됨. Affinity purification 방식으로 높은 특이성과 재현성 보장. Human에 반응하며 Mouse, Rat과 83% 서열 유사성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EPHX1 Antibody
Target: epoxide hydrolase 1, microsomal (xenobiotic)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): 단백질 발현을 RNA-seq 데이터와 비교하여 고발현 및 저발현 조직에서 검증
- Independent validation (WB): 서로 다른 epitope을 인식하는 독립 항체 간의 단백질 발현 비교를 통해 검증
Product Description
Polyclonal Antibody against Human EPHX1
Alternative Gene Names: EPHX
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | epoxide hydrolase 1, microsomal (xenobiotic) |
| Target Gene | EPHX1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRHPHFKTKIEGLDIHFI |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000038776 (83%), Rat ENSRNOG00000003515 (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative 포함. Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적의 농도 및 조건은 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EPHX4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPHX3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPHX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPHA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPHA8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.