
Atlas Antibodies Anti-SLC6A11 Antibody
상품 한눈에 보기
Human SLC6A11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. GAT3로도 알려진 SLC6A11을 특이적으로 검출하며, PrEST 항원으로 정제되었습니다. PBS 및 글리세롤 완충액에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC6A11 Antibody
Target: solute carrier family 6 (neurotransmitter transporter), member 11
Alternative Gene Name: GAT3
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human SLC6A11.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 6 (neurotransmitter transporter), member 11 |
| Target Gene | SLC6A11 |
| Alternative Name | GAT3 |
| Antigen Sequence | GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000005697 (87%)
- Mouse ENSMUSG00000030307 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC6A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC5A6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC6A12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC5A5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.