
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC6A11 Antibody
상품 한눈에 보기
Human SLC6A11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. GAT3로도 알려진 SLC6A11을 특이적으로 검출하며, PrEST 항원으로 정제되었습니다. PBS 및 글리세롤 완충액에 보존되어 있습니다.
- 카탈로그번호
- HPA037981-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037981-100 Anti-SLC6A11 Antibody, solute carrier family 6 (neurotransmitter transporter), member 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037981-25 Anti-SLC6A11 Antibody, solute carrier family 6 (neurotransmitter transporter), member 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC6A11 Antibody
Anti-SLC6A11 Antibody
Target: solute carrier family 6 (neurotransmitter transporter), member 11
Alternative Gene Name: GAT3
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human SLC6A11.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 6 (neurotransmitter transporter), member 11 |
| Target Gene | SLC6A11 |
| Alternative Name | GAT3 |
| Antigen Sequence | GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000005697 (87%)
- Mouse ENSMUSG00000030307 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



