CacheBy
Atlas Antibodies Anti-SLC6A11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC6A11 Antibody

상품 한눈에 보기

Human SLC6A11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. GAT3로도 알려진 SLC6A11을 특이적으로 검출하며, PrEST 항원으로 정제되었습니다. PBS 및 글리세롤 완충액에 보존되어 있습니다.

카탈로그번호
HPA037981-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037981-100 Anti-SLC6A11 Antibody, solute carrier family 6 (neurotransmitter transporter), member 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037981-25 Anti-SLC6A11 Antibody, solute carrier family 6 (neurotransmitter transporter), member 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC6A11 Antibody

Anti-SLC6A11 Antibody

Target: solute carrier family 6 (neurotransmitter transporter), member 11
Alternative Gene Name: GAT3


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SLC6A11.


Target Information

항목 내용
Target Protein solute carrier family 6 (neurotransmitter transporter), member 11
Target Gene SLC6A11
Alternative Name GAT3
Antigen Sequence GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000005697 (87%)
  • Mouse ENSMUSG00000030307 (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.