Atlas Antibodies Anti-SLC35C2 Antibody
상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA027011-100 | Atlas Antibodies HPA027011-100 Anti-SLC35C2 Antibody, solute carrier family 35 (GDP-fucose transporter), member C2 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA027011-25 | Atlas Antibodies HPA027011-25 Anti-SLC35C2 Antibody, solute carrier family 35 (GDP-fucose transporter), member C2 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-SLC35C2 Antibody
solute carrier family 35 (GDP-fucose transporter), member C2
Recommended Applications
Product Description
Polyclonal Antibody against Human SLC35C2
Alternative Gene Names
bA394O2.1, C20orf5, CGI-15, OVCOV1
Target Protein
solute carrier family 35 (GDP-fucose transporter), member C2
Target Gene
SLC35C2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000017664 (83%)
Rat ENSRNOG00000018649 (80%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|