CacheBy
Atlas Antibodies Anti-SLC35E1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC35E1 Antibody

상품 한눈에 보기

Human SLC35E1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% glycerol 기반 buffer에 보존되어 안정성이 우수합니다.

카탈로그번호
HPA016570-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016570-100 Anti-SLC35E1 Antibody, solute carrier family 35, member E1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016570-25 Anti-SLC35E1 Antibody, solute carrier family 35, member E1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC35E1 Antibody

Anti-SLC35E1 Antibody

Target: solute carrier family 35, member E1 (SLC35E1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SLC35E1.


Alternative Gene Names

  • FLJ14251

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 35, member E1
Target Gene SLC35E1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000012287 (76%)
Mouse ENSMUSG00000019731 (76%)

Antigen Sequence:

NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 결정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.